Multiwell RepliTope(TM) Human (HLA classI Ig-like C1 type domain)

Peptide microarray displaying 19 peptides derived from a peptide scan through HLA class I histocompatibility antigen, A-36 alpha chain of Homo sapiens (Human). Incubation with 20 samples (and one control) in parallel using the Array Slide 24-4 chamber. Protein name: HLA class I histocompatibility antigen, A-36 alpha chain. Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: P30455. Sequence: PKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLT. Protein Length: 87