Multiwell RepliTope(TM) B. anthracis (Small acid-soluble protein (gamma type))
Peptide microarray displaying 21 peptides derived from a peptide scan through Small acid-soluble protein (gamma type) of Bacillus anthracis (strain BC). Incubation with 20 samples (and one control) in parallel using the Array Slide 24-4 chamber. Protein name: Small acid-soluble protein (gamma type). Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: Q84DX8. Sequence: MSKKQQGYNKATSGASIQSTNASYGTEFATETNVQAVKQANAQSEAKKAQASGASIQSTNASYGTEFATETDVHAVKKQNAQSAAKQSQSSSSNQ. Protein Length: 95