We value your privacy

We and our digital partners use cookies on this website. Some of them are necessary for the functionality of the website, but you can decide on the following cookies yourself.

Settings

Accept all

Necessary/functional

It would not be possible to operate the website without these cookies. They include, for example, cookies for storing selected settings or remembering logins.

Always active

Analytics

These cookies are used to measure and analyze traffic to our website (number of visitors, pages viewed, average browsing time, etc.). By consent, you will allow us to obtain data on how you use our site.

PepMix(TM) HPV 16 (Protein E7)

Dodavatel:	JPT Peptide Technologies
Katalogové číslo:	PM-HPV16-E7
Velikost balení:	1 vial containing 15 nmol (appr. 25µg) per peptide
Cena:	NA VYŽÁDÁNÍ
Dostupnost:	NA OBJEDNÁNÍ

PepMix(TM) HPV 16 (Protein E7)

Pool of 22 peptides derived from a peptide scan through Protein E7 of Human papillomavirus type 16 for T cell assays (e.g. ELISPOT). Protein name: Protein E7. Specification: Peptide scan (15mers with 11 aa overlap). UniProt-ID: P03129. Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP. Protein Length: 98

We value your privacy

Necessary/functional

Analytics

Advertisement

PepMix(TM) HPV 16 (Protein E7)

Související produkty + doporučené příslušenství